Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  4. Avatar for Window Group 25. Window Group 1 pt. 2,955

  1. Avatar for hpaege
    1. hpaege Lv 1
    100 pts. 9,152
  2. Avatar for BitSpawn 2. BitSpawn Lv 1 98 pts. 9,143
  3. Avatar for johnmitch 3. johnmitch Lv 1 97 pts. 9,092
  4. Avatar for frood66 4. frood66 Lv 1 95 pts. 9,080
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 93 pts. 9,071
  6. Avatar for pauldunn 6. pauldunn Lv 1 91 pts. 9,059
  7. Avatar for O Seki To 7. O Seki To Lv 1 89 pts. 9,050
  8. Avatar for bertro 8. bertro Lv 1 87 pts. 9,042
  9. Avatar for LociOiling 9. LociOiling Lv 1 85 pts. 9,037
  10. Avatar for mirp 10. mirp Lv 1 83 pts. 9,023

Comments