Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for isaksson 91. isaksson Lv 1 11 pts. 8,537
  2. Avatar for ponderosa 92. ponderosa Lv 1 10 pts. 8,532
  3. Avatar for reefyrob 93. reefyrob Lv 1 10 pts. 8,526
  4. Avatar for jamiexq 94. jamiexq Lv 1 10 pts. 8,524
  5. Avatar for vuvuvu 95. vuvuvu Lv 1 10 pts. 8,503
  6. Avatar for Neil9 96. Neil9 Lv 1 9 pts. 8,501
  7. Avatar for Mr_Jolty 97. Mr_Jolty Lv 1 9 pts. 8,484
  8. Avatar for arginia 98. arginia Lv 1 9 pts. 8,480
  9. Avatar for Colostomy EXPLOSION. 99. Colostomy EXPLOSION. Lv 1 8 pts. 8,459
  10. Avatar for TJOK fan 100. TJOK fan Lv 1 8 pts. 8,400

Comments