Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Lindata 101. Lindata Lv 1 8 pts. 8,392
  2. Avatar for JUMELLE54 102. JUMELLE54 Lv 1 8 pts. 8,389
  3. Avatar for PrettyPony2001 103. PrettyPony2001 Lv 1 7 pts. 8,389
  4. Avatar for trebach 104. trebach Lv 1 7 pts. 8,388
  5. Avatar for Soggy Doglog 105. Soggy Doglog Lv 1 7 pts. 8,372
  6. Avatar for froggs554 106. froggs554 Lv 1 7 pts. 8,363
  7. Avatar for senor pit 107. senor pit Lv 1 6 pts. 8,356
  8. Avatar for Crossed Sticks 108. Crossed Sticks Lv 1 6 pts. 8,346
  9. Avatar for DodoBird 109. DodoBird Lv 1 6 pts. 8,327
  10. Avatar for Truncheon Luncheon 110. Truncheon Luncheon Lv 1 6 pts. 8,306

Comments