Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for JinniaFlyer450 111. JinniaFlyer450 Lv 1 6 pts. 8,305
  2. Avatar for Museka 112. Museka Lv 1 5 pts. 8,301
  3. Avatar for bendbob 113. bendbob Lv 1 5 pts. 8,296
  4. Avatar for Pro Lapser 114. Pro Lapser Lv 1 5 pts. 8,295
  5. Avatar for Grom 115. Grom Lv 1 5 pts. 8,271
  6. Avatar for Jajaboman 116. Jajaboman Lv 1 5 pts. 8,269
  7. Avatar for Merf 117. Merf Lv 1 5 pts. 8,260
  8. Avatar for Petrifolder 118. Petrifolder Lv 1 4 pts. 8,253
  9. Avatar for 01010011111 119. 01010011111 Lv 1 4 pts. 8,244
  10. Avatar for dbuske 120. dbuske Lv 1 4 pts. 8,244

Comments