Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for hada 121. hada Lv 1 4 pts. 8,225
  2. Avatar for ViJay7019 122. ViJay7019 Lv 1 4 pts. 8,221
  3. Avatar for andrewxc 123. andrewxc Lv 1 4 pts. 8,217
  4. Avatar for Festering Wounds 124. Festering Wounds Lv 1 4 pts. 8,215
  5. Avatar for pfeiffelfloyd 125. pfeiffelfloyd Lv 1 4 pts. 8,202
  6. Avatar for NameChangeNeeded01 126. NameChangeNeeded01 Lv 1 3 pts. 8,189
  7. Avatar for jebbiek 127. jebbiek Lv 1 3 pts. 8,180
  8. Avatar for chingsong 128. chingsong Lv 1 3 pts. 8,169
  9. Avatar for Iron pet 129. Iron pet Lv 1 3 pts. 8,155
  10. Avatar for leehaggis 130. leehaggis Lv 1 3 pts. 8,140

Comments