Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Sissue 131. Sissue Lv 1 3 pts. 8,115
  2. Avatar for WBarme1234 132. WBarme1234 Lv 1 3 pts. 8,114
  3. Avatar for tarimo 133. tarimo Lv 1 3 pts. 8,073
  4. Avatar for brgreening 134. brgreening Lv 1 3 pts. 8,051
  5. Avatar for atlas100 135. atlas100 Lv 1 2 pts. 8,035
  6. Avatar for silverberg 136. silverberg Lv 1 2 pts. 8,031
  7. Avatar for fishercat 137. fishercat Lv 1 2 pts. 8,031
  8. Avatar for abiogenesis 138. abiogenesis Lv 1 2 pts. 8,010
  9. Avatar for Pibeagles 139. Pibeagles Lv 1 2 pts. 8,002
  10. Avatar for Arne Heessels 140. Arne Heessels Lv 1 2 pts. 7,976

Comments