Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Jim Fraser 151. Jim Fraser Lv 1 1 pt. 7,859
  2. Avatar for lange 152. lange Lv 1 1 pt. 7,857
  3. Avatar for SouperGenious 153. SouperGenious Lv 1 1 pt. 7,856
  4. Avatar for 20508037 154. 20508037 Lv 1 1 pt. 7,851
  5. Avatar for omerksx 155. omerksx Lv 1 1 pt. 7,845
  6. Avatar for bwkittitas 156. bwkittitas Lv 1 1 pt. 7,842
  7. Avatar for Exonx 157. Exonx Lv 1 1 pt. 7,827
  8. Avatar for BCAA 158. BCAA Lv 1 1 pt. 7,821
  9. Avatar for jtrube1 159. jtrube1 Lv 1 1 pt. 7,813
  10. Avatar for Deleted player 160. Deleted player pts. 7,809

Comments