Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for TheOmnipotentMoleRat 181. TheOmnipotentMoleRat Lv 1 1 pt. 7,538
  2. Avatar for tela 182. tela Lv 1 1 pt. 7,534
  3. Avatar for parsnip 183. parsnip Lv 1 1 pt. 7,507
  4. Avatar for Jaco van As 184. Jaco van As Lv 1 1 pt. 7,505
  5. Avatar for Meggy44 185. Meggy44 Lv 1 1 pt. 7,490
  6. Avatar for girltano 186. girltano Lv 1 1 pt. 7,471
  7. Avatar for cassandraberry81897 187. cassandraberry81897 Lv 1 1 pt. 7,469
  8. Avatar for thegr8guitar 188. thegr8guitar Lv 1 1 pt. 7,466
  9. Avatar for franse 189. franse Lv 1 1 pt. 7,465
  10. Avatar for momadoc 190. momadoc Lv 1 1 pt. 7,460

Comments