Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for gmn 11. gmn Lv 1 82 pts. 9,018
  2. Avatar for WarpSpeed 12. WarpSpeed Lv 1 80 pts. 9,015
  3. Avatar for sheerbliss 13. sheerbliss Lv 1 78 pts. 9,006
  4. Avatar for mimi 14. mimi Lv 1 77 pts. 9,003
  5. Avatar for g_b 15. g_b Lv 1 75 pts. 8,998
  6. Avatar for Deleted player 16. Deleted player pts. 8,988
  7. Avatar for aznarog 17. aznarog Lv 1 72 pts. 8,978
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 70 pts. 8,977
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 69 pts. 8,974
  10. Avatar for pvc78 20. pvc78 Lv 1 67 pts. 8,956

Comments