Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for lamoille 191. lamoille Lv 1 1 pt. 7,447
  2. Avatar for migrainecoffee 192. migrainecoffee Lv 1 1 pt. 7,440
  3. Avatar for cnhrcolemam 193. cnhrcolemam Lv 1 1 pt. 7,417
  4. Avatar for polly66017 194. polly66017 Lv 1 1 pt. 7,388
  5. Avatar for mcas 195. mcas Lv 1 1 pt. 7,352
  6. Avatar for martinf 196. martinf Lv 1 1 pt. 7,340
  7. Avatar for zxana0 197. zxana0 Lv 1 1 pt. 7,335
  8. Avatar for frostschutz 198. frostschutz Lv 1 1 pt. 7,321
  9. Avatar for iankirk1098 199. iankirk1098 Lv 1 1 pt. 7,315
  10. Avatar for Compilenix 200. Compilenix Lv 1 1 pt. 7,312

Comments