Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Beauchat 211. Beauchat Lv 1 1 pt. 7,134
  2. Avatar for Jorge Cantero 212. Jorge Cantero Lv 1 1 pt. 7,125
  3. Avatar for Tac1 213. Tac1 Lv 1 1 pt. 7,122
  4. Avatar for Anamfija 214. Anamfija Lv 1 1 pt. 7,110
  5. Avatar for aspadistra 215. aspadistra Lv 1 1 pt. 7,107
  6. Avatar for abruce 216. abruce Lv 1 1 pt. 7,102
  7. Avatar for bananalabnotes 217. bananalabnotes Lv 1 1 pt. 7,082
  8. Avatar for rossco0407 218. rossco0407 Lv 1 1 pt. 7,071
  9. Avatar for karost 219. karost Lv 1 1 pt. 7,070
  10. Avatar for pawelski 220. pawelski Lv 1 1 pt. 7,051

Comments