Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Birthday_Cakeman 221. Birthday_Cakeman Lv 1 1 pt. 7,045
  2. Avatar for green_frog 222. green_frog Lv 1 1 pt. 7,030
  3. Avatar for wallr1 223. wallr1 Lv 1 1 pt. 6,990
  4. Avatar for LuciferLaw 224. LuciferLaw Lv 1 1 pt. 6,980
  5. Avatar for multaq 225. multaq Lv 1 1 pt. 6,942
  6. Avatar for agnairt 226. agnairt Lv 1 1 pt. 6,898
  7. Avatar for Slipknotfruit 227. Slipknotfruit Lv 1 1 pt. 6,866
  8. Avatar for Fowardint 228. Fowardint Lv 1 1 pt. 6,825
  9. Avatar for Czorio 229. Czorio Lv 1 1 pt. 6,810
  10. Avatar for zkm 230. zkm Lv 1 1 pt. 6,663

Comments