Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 66 pts. 8,951
  2. Avatar for nicobul 22. nicobul Lv 1 65 pts. 8,946
  3. Avatar for gitwut 23. gitwut Lv 1 63 pts. 8,944
  4. Avatar for smilingone 24. smilingone Lv 1 62 pts. 8,936
  5. Avatar for Blipperman 25. Blipperman Lv 1 60 pts. 8,935
  6. Avatar for actiasluna 26. actiasluna Lv 1 59 pts. 8,928
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 58 pts. 8,918
  8. Avatar for grogar7 28. grogar7 Lv 1 56 pts. 8,916
  9. Avatar for KarenCH 29. KarenCH Lv 1 55 pts. 8,908
  10. Avatar for Vredeman 30. Vredeman Lv 1 54 pts. 8,907

Comments