Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for gurch 41. gurch Lv 1 42 pts. 8,828
  2. Avatar for uhuuhu 42. uhuuhu Lv 1 41 pts. 8,820
  3. Avatar for egran48 43. egran48 Lv 1 40 pts. 8,818
  4. Avatar for martin.szew 44. martin.szew Lv 1 39 pts. 8,813
  5. Avatar for fryguy 45. fryguy Lv 1 38 pts. 8,807
  6. Avatar for Norrjane 46. Norrjane Lv 1 37 pts. 8,806
  7. Avatar for Deleted player 47. Deleted player 36 pts. 8,804
  8. Avatar for dettingen 48. dettingen Lv 1 35 pts. 8,802
  9. Avatar for Anfinsen_slept_here 49. Anfinsen_slept_here Lv 1 34 pts. 8,784
  10. Avatar for WonkyDonkey 50. WonkyDonkey Lv 1 33 pts. 8,784

Comments