Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for Glen B 51. Glen B Lv 1 33 pts. 8,780
  2. Avatar for pmdpmd 52. pmdpmd Lv 1 32 pts. 8,779
  3. Avatar for tallguy-13088 53. tallguy-13088 Lv 1 31 pts. 8,779
  4. Avatar for shettler 54. shettler Lv 1 30 pts. 8,742
  5. Avatar for Hiro Protagonist 55. Hiro Protagonist Lv 1 29 pts. 8,740
  6. Avatar for Satina 56. Satina Lv 1 29 pts. 8,735
  7. Avatar for TomTaylor 57. TomTaylor Lv 1 28 pts. 8,730
  8. Avatar for eusair 58. eusair Lv 1 27 pts. 8,726
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 27 pts. 8,724
  10. Avatar for cobaltteal 60. cobaltteal Lv 1 26 pts. 8,712

Comments