Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 7,134
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,107
  3. Avatar for Penn State Biomolecular Engineers 23. Penn State Biomolecular Engineers 1 pt. 2,955
  4. Avatar for Rice Biochemistry 24. Rice Biochemistry 1 pt. 2,955
  5. Avatar for Window Group 25. Window Group 1 pt. 2,955
  1. Avatar for molleke 71. molleke Lv 1 19 pts. 8,656
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 19 pts. 8,654
  3. Avatar for gdnskye 73. gdnskye Lv 1 18 pts. 8,642
  4. Avatar for Deleted player 74. Deleted player pts. 8,640
  5. Avatar for Flagg65a 75. Flagg65a Lv 1 17 pts. 8,638
  6. Avatar for stomjoh 76. stomjoh Lv 1 17 pts. 8,625
  7. Avatar for joremen 77. joremen Lv 1 16 pts. 8,617
  8. Avatar for YeshuaLives 78. YeshuaLives Lv 1 16 pts. 8,611
  9. Avatar for kitek314_pl 79. kitek314_pl Lv 1 15 pts. 8,593
  10. Avatar for t012 80. t012 Lv 1 15 pts. 8,590

Comments