1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Summary

• Created: October 06, 2015
• Expires: October 14, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

• 1. Go Science 100 pts. 9,197
• 2. Anthropic Dreams 81 pts. 9,160
• 3. Gargleblasters 65 pts. 9,087
• 4. Beta Folders 52 pts. 9,078
• 5. HMT heritage 41 pts. 9,050
• 6. Contenders 32 pts. 9,003
• 7. L'Alliance Francophone 24 pts. 8,999
• 8. Void Crushers 18 pts. 8,974
• 9. Italiani Al Lavoro 14 pts. 8,848
• 10. xkcd 10 pts. 8,807

Top evolvers

• 1. Bruno Kestemont 100 pts. 9,197
• 2. gloverd 90 pts. 9,196
• 3. diamond_dust 81 pts. 9,194
• 4. Paulo Roque 72 pts. 9,193
• 5. pauldunn 64 pts. 9,188
• 6. mirp 57 pts. 9,180
• 7. Galaxie 50 pts. 9,160
• 8. KarenCH 44 pts. 9,149
• 9. BitSpawn 39 pts. 9,143
• 10. MaartenDesnouck 34 pts. 9,139