Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Go Science 100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807

  1. Avatar for Sissue 131. Sissue Lv 1 3 pts. 8,115
  2. Avatar for WBarme1234 132. WBarme1234 Lv 1 3 pts. 8,114
  3. Avatar for tarimo 133. tarimo Lv 1 3 pts. 8,073
  4. Avatar for brgreening 134. brgreening Lv 1 3 pts. 8,051
  5. Avatar for atlas100 135. atlas100 Lv 1 2 pts. 8,035
  6. Avatar for silverberg 136. silverberg Lv 1 2 pts. 8,031
  7. Avatar for fishercat 137. fishercat Lv 1 2 pts. 8,031
  8. Avatar for abiogenesis 138. abiogenesis Lv 1 2 pts. 8,010
  9. Avatar for Pibeagles 139. Pibeagles Lv 1 2 pts. 8,002
  10. Avatar for Arne Heessels 140. Arne Heessels Lv 1 2 pts. 7,976

Comments