Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Go Science 100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807

  1. Avatar for Jim Fraser 151. Jim Fraser Lv 1 1 pt. 7,859
  2. Avatar for lange 152. lange Lv 1 1 pt. 7,857
  3. Avatar for SouperGenious 153. SouperGenious Lv 1 1 pt. 7,856
  4. Avatar for 20508037 154. 20508037 Lv 1 1 pt. 7,851
  5. Avatar for omerksx 155. omerksx Lv 1 1 pt. 7,845
  6. Avatar for bwkittitas 156. bwkittitas Lv 1 1 pt. 7,842
  7. Avatar for Exonx 157. Exonx Lv 1 1 pt. 7,827
  8. Avatar for BCAA 158. BCAA Lv 1 1 pt. 7,821
  9. Avatar for jtrube1 159. jtrube1 Lv 1 1 pt. 7,813
  10. Avatar for Deleted player 160. Deleted player pts. 7,809

Comments