Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for HMT heritage 5. HMT heritage 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807
  1. Avatar for gloverd 31. gloverd Lv 1 53 pts. 8,905
  2. Avatar for brow42 32. brow42 Lv 1 51 pts. 8,904
  3. Avatar for viosca 33. viosca Lv 1 50 pts. 8,896
  4. Avatar for Galaxie 34. Galaxie Lv 1 49 pts. 8,890
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 48 pts. 8,873
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 47 pts. 8,865
  7. Avatar for deLaCeiba 37. deLaCeiba Lv 1 46 pts. 8,848
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 45 pts. 8,842
  9. Avatar for nemo7731 39. nemo7731 Lv 1 44 pts. 8,836
  10. Avatar for Paulo Roque 40. Paulo Roque Lv 1 43 pts. 8,829

Comments