Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 17,218
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 10 pts. 16,886
  3. Avatar for Natural Abilities 13. Natural Abilities 7 pts. 16,776
  4. Avatar for xkcd 14. xkcd 6 pts. 16,572
  5. Avatar for Androids 15. Androids 4 pts. 15,862
  6. Avatar for freefolder 16. freefolder 3 pts. 15,744
  7. Avatar for SETI.Germany 17. SETI.Germany 2 pts. 15,557
  8. Avatar for Deleted group 18. Deleted group pts. 15,404
  9. Avatar for Russian team 19. Russian team 1 pt. 14,839
  10. Avatar for Friday Lab 20. Friday Lab 1 pt. 10,694
  1. Avatar for Hiro Protagonist 91. Hiro Protagonist Lv 1 13 pts. 16,925
  2. Avatar for TJOK fan 92. TJOK fan Lv 1 12 pts. 16,924
  3. Avatar for Lindata 93. Lindata Lv 1 12 pts. 16,916
  4. Avatar for deLaCeiba 94. deLaCeiba Lv 1 12 pts. 16,886
  5. Avatar for Punktchen 95. Punktchen Lv 1 11 pts. 16,884
  6. Avatar for hada 96. hada Lv 1 11 pts. 16,853
  7. Avatar for gurch 97. gurch Lv 1 11 pts. 16,833
  8. Avatar for mimi 98. mimi Lv 1 10 pts. 16,830
  9. Avatar for Mohambone 99. Mohambone Lv 1 10 pts. 16,817
  10. Avatar for harvardman 100. harvardman Lv 1 10 pts. 16,801

Comments

Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?