Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 17,218
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 10 pts. 16,886
  3. Avatar for Natural Abilities 13. Natural Abilities 7 pts. 16,776
  4. Avatar for xkcd 14. xkcd 6 pts. 16,572
  5. Avatar for Androids 15. Androids 4 pts. 15,862
  6. Avatar for freefolder 16. freefolder 3 pts. 15,744
  7. Avatar for SETI.Germany 17. SETI.Germany 2 pts. 15,557
  8. Avatar for Deleted group 18. Deleted group pts. 15,404
  9. Avatar for Russian team 19. Russian team 1 pt. 14,839
  10. Avatar for Friday Lab 20. Friday Lab 1 pt. 10,694
  1. Avatar for mitarcher 171. mitarcher Lv 1 1 pt. 12,850
  2. Avatar for Jaco van As 172. Jaco van As Lv 1 1 pt. 12,384
  3. Avatar for atlas100 173. atlas100 Lv 1 1 pt. 12,315
  4. Avatar for trebach 174. trebach Lv 1 1 pt. 12,304
  5. Avatar for LordDeathwing 175. LordDeathwing Lv 1 1 pt. 12,067
  6. Avatar for boondog 176. boondog Lv 1 1 pt. 12,028
  7. Avatar for cnhrcolemam 177. cnhrcolemam Lv 1 1 pt. 12,024
  8. Avatar for 01010011111 178. 01010011111 Lv 1 1 pt. 11,746
  9. Avatar for Cyberkashi 179. Cyberkashi Lv 1 1 pt. 11,713
  10. Avatar for froggs554 180. froggs554 Lv 1 1 pt. 11,689

Comments

Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?