Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 17,218
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 10 pts. 16,886
  3. Avatar for Natural Abilities 13. Natural Abilities 7 pts. 16,776
  4. Avatar for xkcd 14. xkcd 6 pts. 16,572
  5. Avatar for Androids 15. Androids 4 pts. 15,862
  6. Avatar for freefolder 16. freefolder 3 pts. 15,744
  7. Avatar for SETI.Germany 17. SETI.Germany 2 pts. 15,557
  8. Avatar for Deleted group 18. Deleted group pts. 15,404
  9. Avatar for Russian team 19. Russian team 1 pt. 14,839
  10. Avatar for Friday Lab 20. Friday Lab 1 pt. 10,694

  1. Avatar for momadoc 231. momadoc Lv 1 1 pt. 6,955
  2. Avatar for bl44z33r 232. bl44z33r Lv 1 1 pt. 6,107
  3. Avatar for tkbridges14 233. tkbridges14 Lv 1 1 pt. 5,188
  4. Avatar for Aldrovanda 234. Aldrovanda Lv 1 1 pt. 4,903
  5. Avatar for Sydefecks 235. Sydefecks Lv 1 1 pt. 4,775
  6. Avatar for 20525438 236. 20525438 Lv 1 1 pt. 4,103
  7. Avatar for m191644 237. m191644 Lv 1 1 pt. 2,176
  8. Avatar for Gabecoolio 238. Gabecoolio Lv 1 1 pt. 0
  9. Avatar for magmalm 239. magmalm Lv 1 1 pt. 0
  10. Avatar for JeNNeR 240. JeNNeR Lv 1 1 pt. 0

Comments


Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?