Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 10,414
  2. Avatar for Deleted group 22. Deleted group pts. 9,478
  3. Avatar for EVHS AP Biology 23. EVHS AP Biology 1 pt. 8,817
  4. Avatar for CureCoin 24. CureCoin 1 pt. 8,518
  5. Avatar for OU CHEM4923 25. OU CHEM4923 1 pt. 7,845
  6. Avatar for Deleted group 26. Deleted group pts. 7,046
  7. Avatar for foldeRNA 27. foldeRNA 1 pt. 0
  8. Avatar for DSN @ Home 28. DSN @ Home 1 pt. 0
  9. Avatar for Window Group 29. Window Group 1 pt. 0
  10. Avatar for BCMB404-Fall2015 30. BCMB404-Fall2015 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 20,561
  2. Avatar for gmn 2. gmn Lv 1 90 pts. 20,485
  3. Avatar for lamoille 3. lamoille Lv 1 80 pts. 20,480
  4. Avatar for MaartenDesnouck 4. MaartenDesnouck Lv 1 71 pts. 20,429
  5. Avatar for phi16 5. phi16 Lv 1 63 pts. 20,402
  6. Avatar for jamiexq 6. jamiexq Lv 1 55 pts. 20,381
  7. Avatar for nemo7731 7. nemo7731 Lv 1 49 pts. 20,191
  8. Avatar for alwen 8. alwen Lv 1 43 pts. 19,926
  9. Avatar for BitSpawn 9. BitSpawn Lv 1 37 pts. 19,913
  10. Avatar for hansvandenhof 10. hansvandenhof Lv 1 32 pts. 19,697

Comments


Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?