Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 10,414
  2. Avatar for Deleted group 22. Deleted group pts. 9,478
  3. Avatar for EVHS AP Biology 23. EVHS AP Biology 1 pt. 8,817
  4. Avatar for CureCoin 24. CureCoin 1 pt. 8,518
  5. Avatar for OU CHEM4923 25. OU CHEM4923 1 pt. 7,845
  6. Avatar for Deleted group 26. Deleted group pts. 7,046
  7. Avatar for foldeRNA 27. foldeRNA 1 pt. 0
  8. Avatar for DSN @ Home 28. DSN @ Home 1 pt. 0
  9. Avatar for Window Group 29. Window Group 1 pt. 0
  10. Avatar for BCMB404-Fall2015 30. BCMB404-Fall2015 1 pt. 0

  1. Avatar for pmelzer 181. pmelzer Lv 1 1 pt. 11,660
  2. Avatar for hc819002 182. hc819002 Lv 1 1 pt. 11,533
  3. Avatar for AEJensen 183. AEJensen Lv 1 1 pt. 11,396
  4. Avatar for WhityAngel 184. WhityAngel Lv 1 1 pt. 11,395
  5. Avatar for emdee314 185. emdee314 Lv 1 1 pt. 11,103
  6. Avatar for rezaefar 186. rezaefar Lv 1 1 pt. 10,808
  7. Avatar for plh 187. plh Lv 1 1 pt. 10,694
  8. Avatar for Adam Tsou 188. Adam Tsou Lv 1 1 pt. 10,662
  9. Avatar for Kurttobin 189. Kurttobin Lv 1 1 pt. 10,626
  10. Avatar for wurzelwicht 190. wurzelwicht Lv 1 1 pt. 10,574

Comments


Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?