Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,561
  2. Avatar for Go Science 2. Go Science 84 pts. 19,442
  3. Avatar for Deleted group 3. Deleted group pts. 19,338
  4. Avatar for Beta Folders 4. Beta Folders 58 pts. 19,098
  5. Avatar for Contenders 5. Contenders 48 pts. 18,700
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 18,413
  7. Avatar for Gargleblasters 7. Gargleblasters 32 pts. 18,224
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 26 pts. 18,021
  9. Avatar for Void Crushers 9. Void Crushers 20 pts. 17,947
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 16 pts. 17,377

  1. Avatar for pmdpmd 21. pmdpmd Lv 1 68 pts. 18,061
  2. Avatar for alcor29 22. alcor29 Lv 1 66 pts. 18,049
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 65 pts. 18,021
  4. Avatar for nicobul 24. nicobul Lv 1 64 pts. 18,001
  5. Avatar for shettler 25. shettler Lv 1 62 pts. 17,995
  6. Avatar for alwen 26. alwen Lv 1 61 pts. 17,993
  7. Avatar for Museka 27. Museka Lv 1 60 pts. 17,978
  8. Avatar for Timo van der Laan 28. Timo van der Laan Lv 1 58 pts. 17,947
  9. Avatar for dcrwheeler 29. dcrwheeler Lv 1 57 pts. 17,940
  10. Avatar for nemo7731 30. nemo7731 Lv 1 56 pts. 17,839

Comments


Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?