Placeholder image of a protein
Icon representing a puzzle

1148: Unsolved De-novo Freestyle 58: Predicted Contacts

Closed since over 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
October 12, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,561
  2. Avatar for Go Science 2. Go Science 84 pts. 19,442
  3. Avatar for Deleted group 3. Deleted group pts. 19,338
  4. Avatar for Beta Folders 4. Beta Folders 58 pts. 19,098
  5. Avatar for Contenders 5. Contenders 48 pts. 18,700
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 18,413
  7. Avatar for Gargleblasters 7. Gargleblasters 32 pts. 18,224
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 26 pts. 18,021
  9. Avatar for Void Crushers 9. Void Crushers 20 pts. 17,947
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 16 pts. 17,377

  1. Avatar for multaq 251. multaq Lv 1 1 pt. 0
  2. Avatar for pawelski 252. pawelski Lv 1 1 pt. 0
  3. Avatar for agnairt 253. agnairt Lv 1 1 pt. 0
  4. Avatar for AryehK 254. AryehK Lv 1 1 pt. 0
  5. Avatar for dan.vinci 255. dan.vinci Lv 1 1 pt. 0
  6. Avatar for packer 256. packer Lv 1 1 pt. 0
  7. Avatar for IvanoDivano 257. IvanoDivano Lv 1 1 pt. 0
  8. Avatar for x_otm 258. x_otm Lv 1 1 pt. 0
  9. Avatar for sheerbliss 259. sheerbliss Lv 1 1 pt. 0
  10. Avatar for dflear 260. dflear Lv 1 1 pt. 0

Comments


Bruno Kestemont Lv 1

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?