Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 7 pts. 8,361
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 5 pts. 8,361
  3. Avatar for Russian team 13. Russian team 4 pts. 8,334
  4. Avatar for xkcd 14. xkcd 3 pts. 8,257
  5. Avatar for freefolder 15. freefolder 2 pts. 8,206
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,169
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,117
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 8,108
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,997
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 7,812
  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 8,534
  2. Avatar for LociOiling 2. LociOiling Lv 1 89 pts. 8,531
  3. Avatar for smilingone 3. smilingone Lv 1 79 pts. 8,530
  4. Avatar for Deleted player 4. Deleted player pts. 8,527
  5. Avatar for Deleted player 5. Deleted player 62 pts. 8,526
  6. Avatar for Galaxie 6. Galaxie Lv 1 54 pts. 8,518
  7. Avatar for reefyrob 7. reefyrob Lv 1 48 pts. 8,517
  8. Avatar for martin.szew 8. martin.szew Lv 1 42 pts. 8,515
  9. Avatar for bertro 9. bertro Lv 1 36 pts. 8,515
  10. Avatar for gmn 10. gmn Lv 1 31 pts. 8,515

Comments