Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 7 pts. 8,361
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 5 pts. 8,361
  3. Avatar for Russian team 13. Russian team 4 pts. 8,334
  4. Avatar for xkcd 14. xkcd 3 pts. 8,257
  5. Avatar for freefolder 15. freefolder 2 pts. 8,206
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,169
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,117
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 8,108
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,997
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 7,812

  1. Avatar for bamh 121. bamh Lv 1 5 pts. 8,169
  2. Avatar for BCAA 122. BCAA Lv 1 5 pts. 8,169
  3. Avatar for pizpot 123. pizpot Lv 1 5 pts. 8,158
  4. Avatar for Iron pet 124. Iron pet Lv 1 5 pts. 8,157
  5. Avatar for senor pit 125. senor pit Lv 1 5 pts. 8,154
  6. Avatar for SouperGenious 126. SouperGenious Lv 1 5 pts. 8,153
  7. Avatar for johngran 127. johngran Lv 1 4 pts. 8,149
  8. Avatar for ivalnic 128. ivalnic Lv 1 4 pts. 8,148
  9. Avatar for rinze 129. rinze Lv 1 4 pts. 8,146
  10. Avatar for Punktchen 130. Punktchen Lv 1 4 pts. 8,144

Comments