Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 7 pts. 8,361
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 5 pts. 8,361
  3. Avatar for Russian team 13. Russian team 4 pts. 8,334
  4. Avatar for xkcd 14. xkcd 3 pts. 8,257
  5. Avatar for freefolder 15. freefolder 2 pts. 8,206
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,169
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,117
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 8,108
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 7,997
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 7,812

  1. Avatar for alexandrefiset 201. alexandrefiset Lv 1 1 pt. 7,776
  2. Avatar for Silhouette 202. Silhouette Lv 1 1 pt. 7,773
  3. Avatar for franse 203. franse Lv 1 1 pt. 7,770
  4. Avatar for lightnir 204. lightnir Lv 1 1 pt. 7,767
  5. Avatar for kerpowah 205. kerpowah Lv 1 1 pt. 7,761
  6. Avatar for Rosami 206. Rosami Lv 1 1 pt. 7,758
  7. Avatar for BillNye769 207. BillNye769 Lv 1 1 pt. 7,752
  8. Avatar for isantheautumn 208. isantheautumn Lv 1 1 pt. 7,749
  9. Avatar for marie.p 209. marie.p Lv 1 1 pt. 7,741
  10. Avatar for gatsby54 210. gatsby54 Lv 1 1 pt. 7,740

Comments