Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for O Seki To
    1. O Seki To Lv 1
    100 pts. 8,534
  2. Avatar for LociOiling 2. LociOiling Lv 1 89 pts. 8,531
  3. Avatar for smilingone 3. smilingone Lv 1 79 pts. 8,530
  4. Avatar for Deleted player 4. Deleted player pts. 8,527
  5. Avatar for Deleted player 5. Deleted player 62 pts. 8,526
  6. Avatar for Galaxie 6. Galaxie Lv 1 54 pts. 8,518
  7. Avatar for reefyrob 7. reefyrob Lv 1 48 pts. 8,517
  8. Avatar for martin.szew 8. martin.szew Lv 1 42 pts. 8,515
  9. Avatar for bertro 9. bertro Lv 1 36 pts. 8,515
  10. Avatar for gmn 10. gmn Lv 1 31 pts. 8,515

Comments