Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491

  1. Avatar for WarpSpeed
    1. WarpSpeed Lv 1
    100 pts. 8,539
  2. Avatar for O Seki To 2. O Seki To Lv 1 99 pts. 8,535
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 97 pts. 8,530
  4. Avatar for mirp 4. mirp Lv 1 95 pts. 8,518
  5. Avatar for wisky 5. wisky Lv 1 93 pts. 8,516
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 8,507
  7. Avatar for Deleted player 7. Deleted player 90 pts. 8,505
  8. Avatar for BitSpawn 8. BitSpawn Lv 1 88 pts. 8,500
  9. Avatar for hpaege 9. hpaege Lv 1 86 pts. 8,482
  10. Avatar for actiasluna 10. actiasluna Lv 1 85 pts. 8,478

Comments