Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 13 pts. 8,288
  2. Avatar for Pibeagles 92. Pibeagles Lv 1 13 pts. 8,286
  3. Avatar for Ofelya 93. Ofelya Lv 1 12 pts. 8,284
  4. Avatar for froggs554 94. froggs554 Lv 1 12 pts. 8,282
  5. Avatar for lamoille 95. lamoille Lv 1 12 pts. 8,280
  6. Avatar for cinnamonkitty 96. cinnamonkitty Lv 1 11 pts. 8,273
  7. Avatar for fishercat 97. fishercat Lv 1 11 pts. 8,265
  8. Avatar for weitzen 98. weitzen Lv 1 11 pts. 8,261
  9. Avatar for Reldas 99. Reldas Lv 1 10 pts. 8,260
  10. Avatar for fpc 100. fpc Lv 1 10 pts. 8,257

Comments