Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for fryguy 101. fryguy Lv 1 10 pts. 8,257
  2. Avatar for caglar 102. caglar Lv 1 9 pts. 8,251
  3. Avatar for Psych0Active 103. Psych0Active Lv 1 9 pts. 8,247
  4. Avatar for pfeiffelfloyd 104. pfeiffelfloyd Lv 1 9 pts. 8,241
  5. Avatar for Guaraxaim567 105. Guaraxaim567 Lv 1 9 pts. 8,240
  6. Avatar for Satina 106. Satina Lv 1 8 pts. 8,238
  7. Avatar for cherry39 107. cherry39 Lv 1 8 pts. 8,231
  8. Avatar for Bletchley Park 108. Bletchley Park Lv 1 8 pts. 8,229
  9. Avatar for guineapig 109. guineapig Lv 1 8 pts. 8,228
  10. Avatar for Superphosphate 110. Superphosphate Lv 1 7 pts. 8,220

Comments