Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for bamh 121. bamh Lv 1 5 pts. 8,169
  2. Avatar for BCAA 122. BCAA Lv 1 5 pts. 8,169
  3. Avatar for pizpot 123. pizpot Lv 1 5 pts. 8,158
  4. Avatar for Iron pet 124. Iron pet Lv 1 5 pts. 8,157
  5. Avatar for senor pit 125. senor pit Lv 1 5 pts. 8,154
  6. Avatar for SouperGenious 126. SouperGenious Lv 1 5 pts. 8,153
  7. Avatar for johngran 127. johngran Lv 1 4 pts. 8,149
  8. Avatar for ivalnic 128. ivalnic Lv 1 4 pts. 8,148
  9. Avatar for rinze 129. rinze Lv 1 4 pts. 8,146
  10. Avatar for Punktchen 130. Punktchen Lv 1 4 pts. 8,144

Comments