Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for Colostomy EXPLOSION. 221. Colostomy EXPLOSION. Lv 1 1 pt. 7,667
  2. Avatar for Perhonen 222. Perhonen Lv 1 1 pt. 7,664
  3. Avatar for stefano01 223. stefano01 Lv 1 1 pt. 7,651
  4. Avatar for ytsun0 224. ytsun0 Lv 1 1 pt. 7,635
  5. Avatar for Scopper 225. Scopper Lv 1 1 pt. 7,634
  6. Avatar for steveB 226. steveB Lv 1 1 pt. 7,634
  7. Avatar for Deleted player 227. Deleted player pts. 7,630
  8. Avatar for wave327 228. wave327 Lv 1 1 pt. 7,615
  9. Avatar for Sydefecks 229. Sydefecks Lv 1 1 pt. 7,613
  10. Avatar for Kren 230. Kren Lv 1 1 pt. 7,607

Comments