Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for ololobasist 231. ololobasist Lv 1 1 pt. 7,602
  2. Avatar for xvchhrth 232. xvchhrth Lv 1 1 pt. 7,594
  3. Avatar for Ernst Zundel 233. Ernst Zundel Lv 1 1 pt. 7,592
  4. Avatar for roman madala 234. roman madala Lv 1 1 pt. 7,579
  5. Avatar for aspadistra 235. aspadistra Lv 1 1 pt. 7,568
  6. Avatar for KrzychuP 236. KrzychuP Lv 1 1 pt. 7,566
  7. Avatar for LemonToast 237. LemonToast Lv 1 1 pt. 7,559
  8. Avatar for PSClsrw 238. PSClsrw Lv 1 1 pt. 7,538
  9. Avatar for Cpt Tesla 239. Cpt Tesla Lv 1 1 pt. 7,532
  10. Avatar for reddoggoo42 240. reddoggoo42 Lv 1 1 pt. 7,532

Comments