Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for YeshuaLives 41. YeshuaLives Lv 1 44 pts. 8,398
  2. Avatar for smholst 42. smholst Lv 1 44 pts. 8,397
  3. Avatar for grogar7 43. grogar7 Lv 1 43 pts. 8,394
  4. Avatar for mimi 44. mimi Lv 1 42 pts. 8,393
  5. Avatar for Timo van der Laan 45. Timo van der Laan Lv 1 41 pts. 8,392
  6. Avatar for pvc78 46. pvc78 Lv 1 40 pts. 8,391
  7. Avatar for nemo7731 47. nemo7731 Lv 1 39 pts. 8,386
  8. Avatar for phi16 48. phi16 Lv 1 38 pts. 8,385
  9. Avatar for goastano 49. goastano Lv 1 37 pts. 8,383
  10. Avatar for egran48 50. egran48 Lv 1 36 pts. 8,379

Comments