Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for TomTaylor 51. TomTaylor Lv 1 35 pts. 8,376
  2. Avatar for shettler 52. shettler Lv 1 35 pts. 8,371
  3. Avatar for jermainiac 53. jermainiac Lv 1 34 pts. 8,364
  4. Avatar for jobo0502 54. jobo0502 Lv 1 33 pts. 8,364
  5. Avatar for christioanchauvin 55. christioanchauvin Lv 1 32 pts. 8,362
  6. Avatar for kitek314_pl 56. kitek314_pl Lv 1 32 pts. 8,361
  7. Avatar for Bushman 57. Bushman Lv 1 31 pts. 8,361
  8. Avatar for Tweedle Dumb 58. Tweedle Dumb Lv 1 30 pts. 8,359
  9. Avatar for manu8170 59. manu8170 Lv 1 29 pts. 8,354
  10. Avatar for eusair 60. eusair Lv 1 29 pts. 8,351

Comments