Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for jamiexq 61. jamiexq Lv 1 28 pts. 8,349
  2. Avatar for Museka 62. Museka Lv 1 27 pts. 8,347
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 27 pts. 8,347
  4. Avatar for Crossed Sticks 64. Crossed Sticks Lv 1 26 pts. 8,340
  5. Avatar for MaartenDesnouck 65. MaartenDesnouck Lv 1 25 pts. 8,338
  6. Avatar for sheerbliss 66. sheerbliss Lv 1 25 pts. 8,337
  7. Avatar for ComputerMage 67. ComputerMage Lv 1 24 pts. 8,334
  8. Avatar for isaksson 68. isaksson Lv 1 24 pts. 8,330
  9. Avatar for Glen B 69. Glen B Lv 1 23 pts. 8,328
  10. Avatar for hada 70. hada Lv 1 22 pts. 8,324

Comments