Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for tallguy-13088 71. tallguy-13088 Lv 1 22 pts. 8,323
  2. Avatar for Komsomolez 72. Komsomolez Lv 1 21 pts. 8,320
  3. Avatar for SKSbell 73. SKSbell Lv 1 21 pts. 8,316
  4. Avatar for Idiotboy 74. Idiotboy Lv 1 20 pts. 8,313
  5. Avatar for andrewxc 75. andrewxc Lv 1 20 pts. 8,313
  6. Avatar for t012 76. t012 Lv 1 19 pts. 8,313
  7. Avatar for silverberg 77. silverberg Lv 1 19 pts. 8,313
  8. Avatar for arginia 78. arginia Lv 1 18 pts. 8,311
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 18 pts. 8,311
  10. Avatar for gurch 80. gurch Lv 1 17 pts. 8,309

Comments