Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491
  1. Avatar for dettingen 81. dettingen Lv 1 17 pts. 8,308
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 17 pts. 8,306
  3. Avatar for uhuuhu 83. uhuuhu Lv 1 16 pts. 8,305
  4. Avatar for harvardman 84. harvardman Lv 1 16 pts. 8,302
  5. Avatar for Merf 85. Merf Lv 1 15 pts. 8,300
  6. Avatar for strong_base 86. strong_base Lv 1 15 pts. 8,299
  7. Avatar for Anfinsen_slept_here 87. Anfinsen_slept_here Lv 1 14 pts. 8,297
  8. Avatar for ponderosa 88. ponderosa Lv 1 14 pts. 8,296
  9. Avatar for pmdpmd 89. pmdpmd Lv 1 14 pts. 8,296
  10. Avatar for WBarme1234 90. WBarme1234 Lv 1 13 pts. 8,290

Comments