Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for Blipperman 31. Blipperman Lv 1 1 pt. 8,454
  2. Avatar for TomTaylor 32. TomTaylor Lv 1 1 pt. 8,445
  3. Avatar for retiredmichael 33. retiredmichael Lv 1 1 pt. 8,430
  4. Avatar for andrewxc 34. andrewxc Lv 1 1 pt. 8,425
  5. Avatar for actiasluna 35. actiasluna Lv 1 1 pt. 8,424
  6. Avatar for dbuske 36. dbuske Lv 1 1 pt. 8,421
  7. Avatar for ViJay7019 37. ViJay7019 Lv 1 1 pt. 8,421
  8. Avatar for Mark- 38. Mark- Lv 1 1 pt. 8,415
  9. Avatar for ponderosa 39. ponderosa Lv 1 1 pt. 8,398
  10. Avatar for phi16 40. phi16 Lv 1 1 pt. 8,360

Comments