Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for HMT heritage 100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392

  1. Avatar for reefyrob 11. reefyrob Lv 1 83 pts. 8,476
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 81 pts. 8,469
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 80 pts. 8,468
  4. Avatar for gmn 14. gmn Lv 1 78 pts. 8,464
  5. Avatar for LociOiling 15. LociOiling Lv 1 77 pts. 8,463
  6. Avatar for KarenCH 16. KarenCH Lv 1 75 pts. 8,458
  7. Avatar for johnmitch 17. johnmitch Lv 1 74 pts. 8,454
  8. Avatar for bertro 18. bertro Lv 1 72 pts. 8,449
  9. Avatar for Deleted player 19. Deleted player pts. 8,446
  10. Avatar for greepski 20. greepski Lv 1 69 pts. 8,442

Comments