Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for HMT heritage 100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392

  1. Avatar for gaving1 251. gaving1 Lv 1 1 pt. 7,131
  2. Avatar for Jimmy Oh 252. Jimmy Oh Lv 1 1 pt. 6,818
  3. Avatar for baryo_bc 253. baryo_bc Lv 1 1 pt. 6,091
  4. Avatar for swimbug2014 254. swimbug2014 Lv 1 1 pt. 5,921
  5. Avatar for SwissGTO 255. SwissGTO Lv 1 1 pt. 5,720
  6. Avatar for AryehK 256. AryehK Lv 1 1 pt. 5,135
  7. Avatar for jchack10 257. jchack10 Lv 1 1 pt. 4,174
  8. Avatar for Antibrad 258. Antibrad Lv 1 1 pt. 4,174
  9. Avatar for Deleted player 259. Deleted player pts. 4,174
  10. Avatar for angelaleenguyen 260. angelaleenguyen Lv 1 1 pt. 4,174

Comments