Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for tela 131. tela Lv 1 4 pts. 8,132
  2. Avatar for abiogenesis 132. abiogenesis Lv 1 4 pts. 8,131
  3. Avatar for ViJay7019 133. ViJay7019 Lv 1 4 pts. 8,125
  4. Avatar for Auntecedent 134. Auntecedent Lv 1 4 pts. 8,117
  5. Avatar for justjustin 135. justjustin Lv 1 3 pts. 8,117
  6. Avatar for pmlkjn 136. pmlkjn Lv 1 3 pts. 8,117
  7. Avatar for dnpw1 137. dnpw1 Lv 1 3 pts. 8,116
  8. Avatar for girltano 138. girltano Lv 1 3 pts. 8,115
  9. Avatar for Snake bite 139. Snake bite Lv 1 3 pts. 8,114
  10. Avatar for minkim2015 140. minkim2015 Lv 1 3 pts. 8,108

Comments