Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for BitSpawn
    1. BitSpawn Lv 1
    100 pts. 9,364
  2. Avatar for mirp 2. mirp Lv 1 99 pts. 9,325
  3. Avatar for frood66 3. frood66 Lv 1 97 pts. 9,301
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 95 pts. 9,300
  5. Avatar for Galaxie 5. Galaxie Lv 1 93 pts. 9,299
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 9,294
  7. Avatar for LociOiling 7. LociOiling Lv 1 90 pts. 9,279
  8. Avatar for Blipperman 8. Blipperman Lv 1 88 pts. 9,278
  9. Avatar for gloverd 9. gloverd Lv 1 86 pts. 9,277
  10. Avatar for pauldunn 10. pauldunn Lv 1 85 pts. 9,269

Comments