Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,366
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 88 pts. 9,353
  3. Avatar for jamiexq 3. jamiexq Lv 1 77 pts. 9,351
  4. Avatar for gmn 4. gmn Lv 1 68 pts. 9,349
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 59 pts. 9,328
  6. Avatar for diamond_dust 6. diamond_dust Lv 1 51 pts. 9,326
  7. Avatar for pauldunn 7. pauldunn Lv 1 44 pts. 9,324
  8. Avatar for gloverd 8. gloverd Lv 1 38 pts. 9,323
  9. Avatar for mirp 9. mirp Lv 1 32 pts. 9,320
  10. Avatar for dettingen 10. dettingen Lv 1 27 pts. 9,319

Comments