Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,366
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 88 pts. 9,353
  3. Avatar for jamiexq 3. jamiexq Lv 1 77 pts. 9,351
  4. Avatar for gmn 4. gmn Lv 1 68 pts. 9,349
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 59 pts. 9,328
  6. Avatar for diamond_dust 6. diamond_dust Lv 1 51 pts. 9,326
  7. Avatar for pauldunn 7. pauldunn Lv 1 44 pts. 9,324
  8. Avatar for gloverd 8. gloverd Lv 1 38 pts. 9,323
  9. Avatar for mirp 9. mirp Lv 1 32 pts. 9,320
  10. Avatar for dettingen 10. dettingen Lv 1 27 pts. 9,319

Comments