Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718

  1. Avatar for Hiro Protagonist 131. Hiro Protagonist Lv 1 4 pts. 8,696
  2. Avatar for dahast.de 132. dahast.de Lv 1 4 pts. 8,689
  3. Avatar for wudoo 133. wudoo Lv 1 4 pts. 8,689
  4. Avatar for bwkittitas 134. bwkittitas Lv 1 4 pts. 8,689
  5. Avatar for fpc 135. fpc Lv 1 3 pts. 8,686
  6. Avatar for Sydefecks 136. Sydefecks Lv 1 3 pts. 8,682
  7. Avatar for isaksson 137. isaksson Lv 1 3 pts. 8,658
  8. Avatar for Ernst Zundel 138. Ernst Zundel Lv 1 3 pts. 8,651
  9. Avatar for Dantoto 139. Dantoto Lv 1 3 pts. 8,647
  10. Avatar for tela 140. tela Lv 1 3 pts. 8,637

Comments